Papio anubis (olive baboon): 101013268 Help Entry 101013268         CDS       T07474                                  Symbol S100A10 Name (RefSeq) protein S100-A10 isoform X2   KO K17274   protein S100-A10 Organism panu  Papio anubis (olive baboon) Pathway panu04382   Cornified envelope formation panu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:panu00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     101013268 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101013268 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:panu04147]     101013268 (S100A10) Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of microglial cells    101013268 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  101013268 NCBI-ProteinID:  XP_003892671 Ensembl:  ENSPANG00000032390 LinkDB All DBs Position 1:complement(122542649..122553789) Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggagcatgccatggaaaccatgatgtttacatttcacaaattcgcg ggggataaaggctacttaacaaaggaggacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccctctggccgtggacaaaataatgaaggacctggac cagtgcagagatggcaaagtgggcttccagagcttcttttccctaattgcgggcctcacc attgcatgcaatgactattttgtagtacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system