Papio anubis (olive baboon): 101014385 Help Entry 101014385         CDS       T07474                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism panu  Papio anubis (olive baboon) Pathway panu04140   Autophagy - animal panu04144   Endocytosis panu04152   AMPK signaling pathway panu04530   Tight junction panu04972   Pancreatic secretion panu05014   Amyotrophic lateral sclerosis panu05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     101014385 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101014385 (RAB8A)    04140 Autophagy - animal     101014385 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     101014385 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     101014385 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101014385 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     101014385 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:panu04131]     101014385 (RAB8A)    03036 Chromosome and associated proteins [BR:panu03036]     101014385 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:panu04147]     101014385 (RAB8A)    04031 GTP-binding proteins [BR:panu04031]     101014385 (RAB8A) Membrane trafficking [BR:panu04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     101014385 (RAB8A)  Autophagy   Other autophagy associated proteins     101014385 (RAB8A) Chromosome and associated proteins [BR:panu03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     101014385 (RAB8A) Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101014385 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    101014385 (RAB8A)   Exosomal proteins of colorectal cancer cells    101014385 (RAB8A) GTP-binding proteins [BR:panu04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     101014385 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  101014385 NCBI-ProteinID:  XP_003915145 Ensembl:  ENSPANG00000031542 LinkDB All DBs Position 20:complement(36020179..36043018) Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccacttttatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaaactgcag atatgggacacggctggtcaggaacggtttcggacgatcacaacggcctactacaggggc gcaatgggcatcatgctggtgtacgacatcaccaacgagaagtccttcgacaacatccgg aactggattcgcaacattgaggagcacgcctctgcagacgtcgaaaagatgatactcgga aacaagtgtgatgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc ctcgactatggaatcaagttcatggagaccagcgcgaaggccaacatcaacgtggaaaat gcatttttcactctcgccagagacatcaaagcaaaaatggacaaaaaattggaaggcaac agcccccaggggagcaaccagggagtcaaaatcacaccggaccagcagaagaggagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system