Papio anubis (olive baboon): 101015078 Help Entry 101015078         CDS       T07474                                  Name (RefSeq) tumor suppressor ARF-like   KO K06621   cyclin-dependent kinase inhibitor 2A Organism panu  Papio anubis (olive baboon) Pathway panu01522   Endocrine resistance panu01524   Platinum drug resistance panu04110   Cell cycle panu04115   p53 signaling pathway panu04218   Cellular senescence panu04934   Cushing syndrome panu05163   Human cytomegalovirus infection panu05166   Human T-cell leukemia virus 1 infection panu05200   Pathways in cancer panu05203   Viral carcinogenesis panu05206   MicroRNAs in cancer panu05212   Pancreatic cancer panu05214   Glioma panu05218   Melanoma panu05219   Bladder cancer panu05220   Chronic myeloid leukemia panu05223   Non-small cell lung cancer panu05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:panu00001]  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     101015078    04115 p53 signaling pathway     101015078    04218 Cellular senescence     101015078  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101015078    05206 MicroRNAs in cancer     101015078    05203 Viral carcinogenesis     101015078   09162 Cancer: specific types    05212 Pancreatic cancer     101015078    05225 Hepatocellular carcinoma     101015078    05214 Glioma     101015078    05220 Chronic myeloid leukemia     101015078    05218 Melanoma     101015078    05219 Bladder cancer     101015078    05223 Non-small cell lung cancer     101015078   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101015078    05163 Human cytomegalovirus infection     101015078   09167 Endocrine and metabolic disease    04934 Cushing syndrome     101015078   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     101015078    01522 Endocrine resistance     101015078 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P19Arf_N Motif Other DBs NCBI-GeneID:  101015078 NCBI-ProteinID:  XP_021783162 LinkDB All DBs Position 13:complement(50543090..50546175) Genome browser AA seq 129 aa AA seqDB search MGRGRRVGPSLQLGGQERRCSPLVPKGGAAAAELGSGGGENMVRRFLVTLRIRRACGPPR VRVFVVHIPRLAGEWAAPGAPAAVALVLMLLRSQRLGQQPHPRRPGRKGPRKVRGAFDTC FVWCDFVNR NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgggcagggggcggcgcgtgggtcccagtctgcagttaggggggcaggagcggcgctgc tcacctctggtgccaaagggcggcgcagcggctgccgagctcggcagtggaggcggcgag aacatggtgcgcaggttcttggtgaccctccggattcggcgcgcgtgcggcccgccgcga gtgagggttttcgtggttcacatcccgcggctcgcgggggagtgggcagcgccaggggcg cccgccgctgtggccctcgtgctgatgctactgaggagccagcgtctagggcagcagccg catcctagaagaccaggtaggaaaggccctcgaaaagtccggggcgcattcgacacttgt tttgtttggtgtgatttcgtaaacagataa

DBGET integrated database retrieval system