Papio anubis (olive baboon): 101016765 Help Entry 101016765         CDS       T07474                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism panu  Papio anubis (olive baboon) Pathway panu04613   Neutrophil extracellular trap formation panu05034   Alcoholism panu05202   Transcriptional misregulation in cancer panu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:panu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101016765  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101016765   09163 Immune disease    05322 Systemic lupus erythematosus     101016765   09165 Substance dependence    05034 Alcoholism     101016765  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:panu03036]     101016765   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:panu04147]     101016765 Chromosome and associated proteins [BR:panu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101016765 Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101016765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  101016765 NCBI-ProteinID:  XP_009202890 Ensembl:  ENSPANG00000029294 UniProt:  A0A096MPD3 LinkDB All DBs Position 6:27627206..27629618 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcgcgtacgaagcagactgctcgcaagtccaccggcggcaaggctccgcgcaagcag ctggctacgaaggcggctcggaagagcgctccggccaccggcggcgtcaagaagccccat cgctaccggcctggtacagtggctctccgcgagatccgccgctaccagaagtccaccgag ctgctgatcagaaagttgccttttcagcgtctggtgcgagagatcgcgcaggactttaag accgacctgcgctttcagagctcggcggtgatggcgctgcaagaggcatgcgaggcctac ctggtggggctctttgaggacaccaacctgtgcgccatccacgccaagagggtgactatc atgcccaaggatatccagctcgcacgtcgtatccgcggcgagagggcttga

DBGET integrated database retrieval system