Papio anubis (olive baboon): 101016803 Help Entry 101016803         CDS       T07474                                  Name (RefSeq) myosin light polypeptide 6   KO K12751   myosin light chain 6 Organism panu  Papio anubis (olive baboon) Pathway panu04270   Vascular smooth muscle contraction panu04517   IgSF CAM signaling panu04530   Tight junction panu04814   Motor proteins panu04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     101016803  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     101016803   09142 Cell motility    04814 Motor proteins     101016803  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     101016803   09153 Circulatory system    04270 Vascular smooth muscle contraction     101016803  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:panu04812]     101016803    04147 Exosome [BR:panu04147]     101016803 Cytoskeleton proteins [BR:panu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      101016803 Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101016803   Exosomal proteins of bladder cancer cells    101016803 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_6 EF-hand_7 AIF-1 EF_EFCAB10_C EF-hand_5 EF-hand_9 Motif Other DBs NCBI-GeneID:  101016803 NCBI-ProteinID:  XP_003918279 UniProt:  A0A096MR13 LinkDB All DBs Position X:complement(32202939..32203647) Genome browser AA seq 151 aa AA seqDB search MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM TEEEVEMLVAGHEDSNGCINYEELVRMVLNG NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtgtgacttcaccgaagaccagactgcagagttcaaggaggccttccagctgtttgac cgaacaggtgatggcaagatcctgtacagccagtgtggggacgtgatgagggccctgggc cagaaccctaccaacgccgaggtgctcaaggtcctggggaaccccaagagtgatgagatg aatgtgaaggtgctggactttgagcactttctgcccatgctgcagacagtggccaagaac aaggaccagggcacctatgaggattatgtcgaaggacttcgggtgtttgacaaggaagga aatggcaccgtcatgggtgccgaaatccggcatgttcttgtcacactgggtgagaagatg acagaggaagaagtagagatgctggtggcagggcacgaggacagcaatggttgtatcaac tatgaagagctcgtccgcatggtgctgaatggctga

DBGET integrated database retrieval system