Papio anubis (olive baboon): 101017532 Help Entry 101017532         CDS       T07474                                  Symbol CALML6 Name (RefSeq) calmodulin-like protein 6   KO K02183   calmodulin Organism panu  Papio anubis (olive baboon) Pathway panu04014   Ras signaling pathway panu04015   Rap1 signaling pathway panu04020   Calcium signaling pathway panu04022   cGMP-PKG signaling pathway panu04024   cAMP signaling pathway panu04070   Phosphatidylinositol signaling system panu04114   Oocyte meiosis panu04218   Cellular senescence panu04261   Adrenergic signaling in cardiomyocytes panu04270   Vascular smooth muscle contraction panu04371   Apelin signaling pathway panu04625   C-type lectin receptor signaling pathway panu04713   Circadian entrainment panu04720   Long-term potentiation panu04722   Neurotrophin signaling pathway panu04728   Dopaminergic synapse panu04740   Olfactory transduction panu04744   Phototransduction panu04750   Inflammatory mediator regulation of TRP channels panu04910   Insulin signaling pathway panu04912   GnRH signaling pathway panu04915   Estrogen signaling pathway panu04916   Melanogenesis panu04921   Oxytocin signaling pathway panu04922   Glucagon signaling pathway panu04924   Renin secretion panu04925   Aldosterone synthesis and secretion panu04970   Salivary secretion panu04971   Gastric acid secretion panu05010   Alzheimer disease panu05012   Parkinson disease panu05022   Pathways of neurodegeneration - multiple diseases panu05031   Amphetamine addiction panu05034   Alcoholism panu05133   Pertussis panu05152   Tuberculosis panu05163   Human cytomegalovirus infection panu05167   Kaposi sarcoma-associated herpesvirus infection panu05170   Human immunodeficiency virus 1 infection panu05200   Pathways in cancer panu05214   Glioma panu05417   Lipid and atherosclerosis panu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101017532 (CALML6)    04015 Rap1 signaling pathway     101017532 (CALML6)    04371 Apelin signaling pathway     101017532 (CALML6)    04020 Calcium signaling pathway     101017532 (CALML6)    04070 Phosphatidylinositol signaling system     101017532 (CALML6)    04024 cAMP signaling pathway     101017532 (CALML6)    04022 cGMP-PKG signaling pathway     101017532 (CALML6)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     101017532 (CALML6)    04218 Cellular senescence     101017532 (CALML6)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101017532 (CALML6)   09152 Endocrine system    04910 Insulin signaling pathway     101017532 (CALML6)    04922 Glucagon signaling pathway     101017532 (CALML6)    04912 GnRH signaling pathway     101017532 (CALML6)    04915 Estrogen signaling pathway     101017532 (CALML6)    04921 Oxytocin signaling pathway     101017532 (CALML6)    04916 Melanogenesis     101017532 (CALML6)    04924 Renin secretion     101017532 (CALML6)    04925 Aldosterone synthesis and secretion     101017532 (CALML6)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     101017532 (CALML6)    04270 Vascular smooth muscle contraction     101017532 (CALML6)   09154 Digestive system    04970 Salivary secretion     101017532 (CALML6)    04971 Gastric acid secretion     101017532 (CALML6)   09156 Nervous system    04728 Dopaminergic synapse     101017532 (CALML6)    04720 Long-term potentiation     101017532 (CALML6)    04722 Neurotrophin signaling pathway     101017532 (CALML6)   09157 Sensory system    04744 Phototransduction     101017532 (CALML6)    04740 Olfactory transduction     101017532 (CALML6)    04750 Inflammatory mediator regulation of TRP channels     101017532 (CALML6)   09159 Environmental adaptation    04713 Circadian entrainment     101017532 (CALML6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101017532 (CALML6)   09162 Cancer: specific types    05214 Glioma     101017532 (CALML6)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101017532 (CALML6)    05163 Human cytomegalovirus infection     101017532 (CALML6)    05167 Kaposi sarcoma-associated herpesvirus infection     101017532 (CALML6)   09171 Infectious disease: bacterial    05133 Pertussis     101017532 (CALML6)    05152 Tuberculosis     101017532 (CALML6)   09164 Neurodegenerative disease    05010 Alzheimer disease     101017532 (CALML6)    05012 Parkinson disease     101017532 (CALML6)    05022 Pathways of neurodegeneration - multiple diseases     101017532 (CALML6)   09165 Substance dependence    05031 Amphetamine addiction     101017532 (CALML6)    05034 Alcoholism     101017532 (CALML6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101017532 (CALML6)    05418 Fluid shear stress and atherosclerosis     101017532 (CALML6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:panu01009]     101017532 (CALML6)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:panu04131]     101017532 (CALML6)    03036 Chromosome and associated proteins [BR:panu03036]     101017532 (CALML6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:panu04147]     101017532 (CALML6) Protein phosphatases and associated proteins [BR:panu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      101017532 (CALML6) Membrane trafficking [BR:panu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     101017532 (CALML6) Chromosome and associated proteins [BR:panu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      101017532 (CALML6) Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101017532 (CALML6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_5 EH EF-hand_FSTL1 EFhand_Ca_insen EF_EFCAB10_C Motif Other DBs NCBI-GeneID:  101017532 NCBI-ProteinID:  XP_021790797 Ensembl:  ENSPANG00000000394 LinkDB All DBs Position 1:987679..991269 Genome browser AA seq 138 aa AA seqDB search MFDEEGNGEVKTGELERLMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFLALMGVYHE KAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEADKDGDGTI DYEEFVAMMTGESFKLIQ NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgtttgatgaagagggcaacggggaggtgaagacgggggagctggagcggctcatgagc ctgctgggtatcaaccccaccaagagtgagctggcctcgatggccaaggacgtggacaga gacaacaaagggttcttcaactgcgatggtttcctggcactaatgggagtttaccatgag aaggcccagaaccaggagagcgagctgagggcggcattccgcgtcttcgacaaagagggc aagggctacattgattggaacacactcaagtacgtgctcatgaatgcaggggagcccctc aacgaggtggaggcggagcagatgatgaaggaggctgacaaggacggggacgggaccatc gactatgaggagtttgtggccatgatgaccggggagtccttcaagctgatccagtag

DBGET integrated database retrieval system