Papio anubis (olive baboon): 101018174 Help Entry 101018174         CDS       T07474                                  Name (RefSeq) LOW QUALITY PROTEIN: histone H4   KO K11253   histone H3 Organism panu  Papio anubis (olive baboon) Pathway panu04613   Neutrophil extracellular trap formation panu05034   Alcoholism panu05202   Transcriptional misregulation in cancer panu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:panu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101018174  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101018174   09163 Immune disease    05322 Systemic lupus erythematosus     101018174   09165 Substance dependence    05034 Alcoholism     101018174  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:panu03036]     101018174   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:panu04147]     101018174 Chromosome and associated proteins [BR:panu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101018174 Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101018174 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CBFD_NFYB_HMF CENP-S Motif Other DBs NCBI-GeneID:  101018174 NCBI-ProteinID:  XP_003897266 Ensembl:  ENSPANG00000035162 UniProt:  A0A096N7J3 LinkDB All DBs Position 6:27641135..27641496 Genome browser AA seq 104 aa AA seqDB search MSGRGKGGXGLGSCAKRHRXVLRDNIQGITKPVPSGFLVRGGVKRISGPIYEEIPVGALE KSSLENVIRDAXDSTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgcggcaaaggcgganagggtcttggcagttgcgctaagcgccaccggnca gtgctgcgtgacaacatccagggcatcaccaagccggtgccatccggtttccttgttcgc ggcggcgtgaagcgcatctctggccccatctacgaggagattcccgtgggtgcgctggaa aagtcttccctggagaacgtgatccgggacgccnnagactccacggagcacgccaagcgc aagacagtcaccgccatggatgtggtttacgcgctgaagcgccagggtcgcaccctctac ggtttcggtggctga

DBGET integrated database retrieval system