Papio anubis (olive baboon): 101018287 Help Entry 101018287         CDS       T07474                                  Name (RefSeq) interferon alpha-2   KO K05414   interferon alpha Organism panu  Papio anubis (olive baboon) Pathway panu04060   Cytokine-cytokine receptor interaction panu04151   PI3K-Akt signaling pathway panu04217   Necroptosis panu04620   Toll-like receptor signaling pathway panu04621   NOD-like receptor signaling pathway panu04622   RIG-I-like receptor signaling pathway panu04623   Cytosolic DNA-sensing pathway panu04630   JAK-STAT signaling pathway panu04650   Natural killer cell mediated cytotoxicity panu04936   Alcoholic liver disease panu05152   Tuberculosis panu05160   Hepatitis C panu05161   Hepatitis B panu05162   Measles panu05163   Human cytomegalovirus infection panu05164   Influenza A panu05165   Human papillomavirus infection panu05167   Kaposi sarcoma-associated herpesvirus infection panu05168   Herpes simplex virus 1 infection panu05169   Epstein-Barr virus infection panu05170   Human immunodeficiency virus 1 infection panu05171   Coronavirus disease - COVID-19 panu05200   Pathways in cancer panu05320   Autoimmune thyroid disease panu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101018287    04151 PI3K-Akt signaling pathway     101018287   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101018287  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101018287  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101018287    04621 NOD-like receptor signaling pathway     101018287    04622 RIG-I-like receptor signaling pathway     101018287    04623 Cytosolic DNA-sensing pathway     101018287    04650 Natural killer cell mediated cytotoxicity     101018287  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101018287   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101018287    05161 Hepatitis B     101018287    05160 Hepatitis C     101018287    05171 Coronavirus disease - COVID-19     101018287    05164 Influenza A     101018287    05162 Measles     101018287    05168 Herpes simplex virus 1 infection     101018287    05163 Human cytomegalovirus infection     101018287    05167 Kaposi sarcoma-associated herpesvirus infection     101018287    05169 Epstein-Barr virus infection     101018287    05165 Human papillomavirus infection     101018287   09171 Infectious disease: bacterial    05152 Tuberculosis     101018287   09163 Immune disease    05320 Autoimmune thyroid disease     101018287   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101018287   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101018287  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:panu04052]     101018287 Cytokines and neuropeptides [BR:panu04052]  Cytokines   Interferons    101018287 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon iSTAND Spo16_N CoV_NSP2_N Motif Other DBs NCBI-GeneID:  101018287 NCBI-ProteinID:  XP_003911705 LinkDB All DBs Position 13:complement(49923045..49925918) Genome browser AA seq 188 aa AA seqDB search MALTFALLVALVVLSCKSSCSLGCDLPQTHSLGNRRTLMLLAQMRRISLFFCLKDRHDFE FPQEEFGNQFQKAQTIPVLHEMIQQTFNLFSTKDSSAAWDETLLNKFYTELYQQLNDLEA CVMQEMGVTETPLMNKNSILAVRKYFQRLTLYLKEKKYSLCAWEVVRAEIMRSFSLSTNL QESLRSKE NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atggccttgacctttgctttactggtggccctggtggtgctcagctgcaagtcaagctgc tctctgggctgtgatctacctcaaacccacagcctgggtaacaggaggaccttgatgctc ctggcacaaatgaggagaatctctcttttcttctgcctgaaggacagacatgactttgaa tttccccaggaggagtttggcaaccagttccaaaaggctcaaaccatccctgtcctccat gagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctgcttgggat gagaccctcctaaacaaattctacactgaactctaccagcagctgaatgacctggaagcc tgtgtgatgcaggagatgggggtgacagagactcccctgatgaacaagaactccatcctg gccgtgaggaaatacttccaaagactcactctctatctgaaagagaagaaatacagtctt tgtgcctgggaggttgtcagagcagaaattatgagatctttttctttgtcaacaaacttg caagaaagtttaagaagtaaggaatga

DBGET integrated database retrieval system