Papio anubis (olive baboon): 101019436 Help Entry 101019436         CDS       T07474                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism panu  Papio anubis (olive baboon) Pathway panu01521   EGFR tyrosine kinase inhibitor resistance panu01524   Platinum drug resistance panu04014   Ras signaling pathway panu04064   NF-kappa B signaling pathway panu04115   p53 signaling pathway panu04137   Mitophagy - animal panu04140   Autophagy - animal panu04151   PI3K-Akt signaling pathway panu04210   Apoptosis panu04215   Apoptosis - multiple species panu04621   NOD-like receptor signaling pathway panu04630   JAK-STAT signaling pathway panu05012   Parkinson disease panu05014   Amyotrophic lateral sclerosis panu05022   Pathways of neurodegeneration - multiple diseases panu05145   Toxoplasmosis panu05162   Measles panu05166   Human T-cell leukemia virus 1 infection panu05168   Herpes simplex virus 1 infection panu05170   Human immunodeficiency virus 1 infection panu05200   Pathways in cancer panu05202   Transcriptional misregulation in cancer panu05212   Pancreatic cancer panu05220   Chronic myeloid leukemia panu05222   Small cell lung cancer panu05225   Hepatocellular carcinoma panu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101019436 (BCL2L1)    04630 JAK-STAT signaling pathway     101019436 (BCL2L1)    04064 NF-kappa B signaling pathway     101019436 (BCL2L1)    04151 PI3K-Akt signaling pathway     101019436 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101019436 (BCL2L1)    04137 Mitophagy - animal     101019436 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     101019436 (BCL2L1)    04215 Apoptosis - multiple species     101019436 (BCL2L1)    04115 p53 signaling pathway     101019436 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101019436 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101019436 (BCL2L1)    05202 Transcriptional misregulation in cancer     101019436 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     101019436 (BCL2L1)    05225 Hepatocellular carcinoma     101019436 (BCL2L1)    05220 Chronic myeloid leukemia     101019436 (BCL2L1)    05222 Small cell lung cancer     101019436 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101019436 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     101019436 (BCL2L1)    05162 Measles     101019436 (BCL2L1)    05168 Herpes simplex virus 1 infection     101019436 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101019436 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     101019436 (BCL2L1)    05014 Amyotrophic lateral sclerosis     101019436 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     101019436 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101019436 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101019436 (BCL2L1)    01524 Platinum drug resistance     101019436 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:panu01009]     101019436 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:panu03036]     101019436 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:panu02000]     101019436 (BCL2L1) Protein phosphatases and associated proteins [BR:panu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      101019436 (BCL2L1) Chromosome and associated proteins [BR:panu03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     101019436 (BCL2L1) Transporters [BR:panu02000]  Other transporters   Pores ion channels [TC:1]    101019436 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  101019436 NCBI-ProteinID:  XP_003904949 Ensembl:  ENSPANG00000023987 UniProt:  A0A8I5MVB8 LinkDB All DBs Position 16:complement(58797836..58858696) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLV DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcaatttagtgatgtggaagagaacaggactgaggccccagaaggg actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggtg gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg taccggcgggcgttcagtgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctatgggaacaatgcagca gccgagagccgaaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gccggcgtggttctgctaggctcactcttcagtcggaaatga

DBGET integrated database retrieval system