Papio anubis (olive baboon): 101021708 Help Entry 101021708         CDS       T07474                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism panu  Papio anubis (olive baboon) Pathway panu03010   Ribosome panu04120   Ubiquitin mediated proteolysis panu04137   Mitophagy - animal panu04140   Autophagy - animal panu05012   Parkinson disease panu05022   Pathways of neurodegeneration - multiple diseases panu05167   Kaposi sarcoma-associated herpesvirus infection panu05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:panu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     101021708   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     101021708  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101021708    04137 Mitophagy - animal     101021708  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     101021708    05167 Kaposi sarcoma-associated herpesvirus infection     101021708   09164 Neurodegenerative disease    05012 Parkinson disease     101021708    05022 Pathways of neurodegeneration - multiple diseases     101021708  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:panu03011]     101021708    04121 Ubiquitin system [BR:panu04121]     101021708   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:panu04147]     101021708 Ribosome [BR:panu03011]  Ribosomal proteins   Eukaryotes    Small subunit     101021708   Archaea     101021708 Ubiquitin system [BR:panu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    101021708 Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101021708   Exosomal proteins of colorectal cancer cells    101021708 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ribosomal_S27 Ubiquitin_2 Rad60-SLD_2 Dsc3_N Ubiquitin_5 TBK1_ULD DUF2604 Motif Other DBs NCBI-GeneID:  101021708 NCBI-ProteinID:  XP_031509872 Ensembl:  ENSPANG00000032666 LinkDB All DBs Position 13:2050925..2051481 Genome browser AA seq 145 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTTENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE CPSDECGLGCLWQATLTDIIVANVV NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgcagattttcgtgaaaacccttacggggaagaccatcaccctcgaagttgaaccctcg gatacgacagaaaatgtaaaggccaagatccaggataaggaaggaattcctcctgatcag caaagactgatctttgctggcaagcaactggaagatggacgtactttgtctgactacaat attcaaaaggagtctactcttcatcttgttttgagacttcgtggtggtgctaagaaaagg aagaagaagtcttacaccactcccaagaagaataagcacaagagaaagaaggttaagctg gctgtcctgaaatattataaggtggatgagaatggcaaaattagtcgccttcgtcgagag tgcccatctgatgaatgtgggctggggtgtttatggcaagccactttgacagacattatt gtggcaaatgttgtctga

DBGET integrated database retrieval system