Papio anubis (olive baboon): 101022918 Help Entry 101022918         CDS       T07474                                  Name (RefSeq) metallothionein-2-like   KO K14739   metallothionein 1/2 Organism panu  Papio anubis (olive baboon) Pathway panu04978   Mineral absorption Brite KEGG Orthology (KO) [BR:panu00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     101022918  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:panu03019]     101022918    03029 Mitochondrial biogenesis [BR:panu03029]     101022918 Messenger RNA biogenesis [BR:panu03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      101022918 Mitochondrial biogenesis [BR:panu03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     101022918 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  101022918 NCBI-ProteinID:  XP_009194738 Ensembl:  ENSPANG00000020493 LinkDB All DBs Position 18:complement(33184293..33185665) Genome browser AA seq 61 aa AA seqDB search MDPNCSCSAGDSCTCADSCKCKECTCPSCKKSCCSCCPVGCAKCAQGCICKGALDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgctccgctggtgactcctgcacctgcgccgactcctgcaag tgcaaagagtgcacatgcccctcctgcaagaagagctgctgctcctgctgccctgtgggc tgtgccaagtgtgcccagggctgcatctgcaaaggggccttggacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system