Papio anubis (olive baboon): 101023751 Help Entry 101023751         CDS       T07474                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism panu  Papio anubis (olive baboon) Pathway panu04024   cAMP signaling pathway panu04062   Chemokine signaling pathway panu04064   NF-kappa B signaling pathway panu04210   Apoptosis panu04380   Osteoclast differentiation panu04620   Toll-like receptor signaling pathway panu04621   NOD-like receptor signaling pathway panu04622   RIG-I-like receptor signaling pathway panu04623   Cytosolic DNA-sensing pathway panu04625   C-type lectin receptor signaling pathway panu04657   IL-17 signaling pathway panu04658   Th1 and Th2 cell differentiation panu04659   Th17 cell differentiation panu04660   T cell receptor signaling pathway panu04662   B cell receptor signaling pathway panu04668   TNF signaling pathway panu04722   Neurotrophin signaling pathway panu04920   Adipocytokine signaling pathway panu04926   Relaxin signaling pathway panu04931   Insulin resistance panu04936   Alcoholic liver disease panu05132   Salmonella infection panu05134   Legionellosis panu05135   Yersinia infection panu05140   Leishmaniasis panu05142   Chagas disease panu05145   Toxoplasmosis panu05160   Hepatitis C panu05161   Hepatitis B panu05162   Measles panu05163   Human cytomegalovirus infection panu05164   Influenza A panu05166   Human T-cell leukemia virus 1 infection panu05167   Kaposi sarcoma-associated herpesvirus infection panu05168   Herpes simplex virus 1 infection panu05169   Epstein-Barr virus infection panu05170   Human immunodeficiency virus 1 infection panu05171   Coronavirus disease - COVID-19 panu05200   Pathways in cancer panu05203   Viral carcinogenesis panu05208   Chemical carcinogenesis - reactive oxygen species panu05215   Prostate cancer panu05220   Chronic myeloid leukemia panu05222   Small cell lung cancer panu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer panu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     101023751 (NFKBIA)    04668 TNF signaling pathway     101023751 (NFKBIA)    04024 cAMP signaling pathway     101023751 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     101023751 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101023751 (NFKBIA)    04621 NOD-like receptor signaling pathway     101023751 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     101023751 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     101023751 (NFKBIA)    04625 C-type lectin receptor signaling pathway     101023751 (NFKBIA)    04660 T cell receptor signaling pathway     101023751 (NFKBIA)    04658 Th1 and Th2 cell differentiation     101023751 (NFKBIA)    04659 Th17 cell differentiation     101023751 (NFKBIA)    04657 IL-17 signaling pathway     101023751 (NFKBIA)    04662 B cell receptor signaling pathway     101023751 (NFKBIA)    04062 Chemokine signaling pathway     101023751 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     101023751 (NFKBIA)    04926 Relaxin signaling pathway     101023751 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     101023751 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     101023751 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101023751 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     101023751 (NFKBIA)    05203 Viral carcinogenesis     101023751 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101023751 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     101023751 (NFKBIA)    05215 Prostate cancer     101023751 (NFKBIA)    05222 Small cell lung cancer     101023751 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101023751 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     101023751 (NFKBIA)    05161 Hepatitis B     101023751 (NFKBIA)    05160 Hepatitis C     101023751 (NFKBIA)    05171 Coronavirus disease - COVID-19     101023751 (NFKBIA)    05164 Influenza A     101023751 (NFKBIA)    05162 Measles     101023751 (NFKBIA)    05168 Herpes simplex virus 1 infection     101023751 (NFKBIA)    05163 Human cytomegalovirus infection     101023751 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     101023751 (NFKBIA)    05169 Epstein-Barr virus infection     101023751 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     101023751 (NFKBIA)    05135 Yersinia infection     101023751 (NFKBIA)    05134 Legionellosis     101023751 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101023751 (NFKBIA)    05140 Leishmaniasis     101023751 (NFKBIA)    05142 Chagas disease     101023751 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101023751 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101023751 (NFKBIA)    04931 Insulin resistance     101023751 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:panu03000]     101023751 (NFKBIA)    04131 Membrane trafficking [BR:panu04131]     101023751 (NFKBIA) Transcription factors [BR:panu03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     101023751 (NFKBIA) Membrane trafficking [BR:panu04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     101023751 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  101023751 NCBI-ProteinID:  XP_003901756 Ensembl:  ENSPANG00000021245 UniProt:  A0A096NUL4 LinkDB All DBs Position 7:71135632..71139535 Genome browser AA seq 317 aa AA seqDB search MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE DELPYDDCVFGGQRLTL NT seq 954 nt NT seq  +upstreamnt  +downstreamnt atgttccaggcggccgagcgcccccaggagtgggccatggagggtccccgcgacgggctg aagaaggaacgactgctggacgaccgccacgacagcggcctggactccatgaaggatgag gagtacgagcagatggtcaaggagctgcaggagatccgcctcgagccgcaggaggtgccg cgcggcgcggagccctggaagcagcagctcaccgaggacggggactcgtttctgcacttg gccatcatccatgaagaaaaggcactgaccatggaagtgatccgccaggtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccagccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcttggccagcgtg ggagtcctgactcagtcctgcaccaccccgcacctccactccatcctgaaggctaccaac tacaatggccacacgtgtctgcacttagcctctatccatggctacctgggcattgtggag cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaacggccggactgcc cttcacctcgcagtggacctgcagaatcctgacctggtgtcgctcctgttgaagtgtggg gctgatgtcaacagagttacctaccagggctattctccctaccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgacgctggaaaaccttcagatgctg ccggagagtgaggatgaggagagctatgacacagagtcagagttcacggagttcacggag gatgagctgccctatgacgactgtgtgtttggaggccagcgtctgacattatga

DBGET integrated database retrieval system