Papio anubis (olive baboon): 101024253 Help Entry 101024253         CDS       T07474                                  Symbol MYL5 Name (RefSeq) myosin light chain 5 isoform X1   KO K12753   myosin regulatory light chain 5 Organism panu  Papio anubis (olive baboon) Pathway panu04360   Axon guidance panu04510   Focal adhesion panu04520   Adherens junction panu04670   Leukocyte transendothelial migration panu04810   Regulation of actin cytoskeleton panu04814   Motor proteins panu04820   Cytoskeleton in muscle cells panu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:panu00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     101024253 (MYL5)    04520 Adherens junction     101024253 (MYL5)   09142 Cell motility    04814 Motor proteins     101024253 (MYL5)    04820 Cytoskeleton in muscle cells     101024253 (MYL5)    04810 Regulation of actin cytoskeleton     101024253 (MYL5)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     101024253 (MYL5)   09158 Development and regeneration    04360 Axon guidance     101024253 (MYL5)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101024253 (MYL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:panu04812]     101024253 (MYL5) Cytoskeleton proteins [BR:panu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      101024253 (MYL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 EF_EFCAB10_C AIF-1 Caleosin Lipoprotein_6 Motif Other DBs NCBI-GeneID:  101024253 NCBI-ProteinID:  XP_009203020 Ensembl:  ENSPANG00000011909 LinkDB All DBs Position 3:complement(184348044..184355766) Genome browser AA seq 178 aa AA seqDB search MVLPLQASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDL KDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNMFGEKLSGTDAEETILNAFKMLDPD GKGKINKEYIKRLLMSQADKMTADEVDQMFQFASIDAAGNPGPKALSYVITHGEEKEE NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atggtgctcccattgcaggccagcaggaagaccaagaagaaggaagggggtgccctccgg gcccagagagcctcatccaatgtcttctccaactttgagcagactcagatccaggagttc aaggaggcattcacactcatggatcagaaccgagacggcttcatcgacaaggaggacctg aaggacacctacgcctccctgggcaagaccaatgtcaaggacgatgagctggacgccatg ctcaaagaggcctcggggcccatcaacttcaccatgtttctgaacatgtttggggagaag ctgagtggtaccgatgccgaggagaccattctaaacgccttcaagatgctggacccagac gggaaagggaaaatcaacaaggagtacatcaagcgtctgctgatgtcccaggctgacaag atgacagcggatgaggtggaccagatgttccagttcgcctccatcgatgccgcgggcaat cctggacctaaggcgctgagctacgtgatcacccacggggaggaaaaggaggagtga

DBGET integrated database retrieval system