Papio anubis (olive baboon): 101024883 Help Entry 101024883         CDS       T07474                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism panu  Papio anubis (olive baboon) Pathway panu04015   Rap1 signaling pathway panu04810   Regulation of actin cytoskeleton panu05014   Amyotrophic lateral sclerosis panu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101024883 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101024883 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101024883 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101024883 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:panu04131]     101024883 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:panu04812]     101024883 (PFN1)    04147 Exosome [BR:panu04147]     101024883 (PFN1) Membrane trafficking [BR:panu04131]  Others   Actin-binding proteins    Others     101024883 (PFN1) Cytoskeleton proteins [BR:panu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101024883 (PFN1) Exosome [BR:panu04147]  Exosomal proteins   Proteins found in most exosomes    101024883 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101024883 NCBI-ProteinID:  XP_009187699 Ensembl:  ENSPANG00000024313 LinkDB All DBs Position 17:complement(4619409..4622822) Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH GGLINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgataacctcatggcggacgggacctgtcaggacgcg gccatcgtgggttacaaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttttac gtcaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctgcag gatggggagtttagcatggatcttcgtaccaagagcaccggtggggcccccaccttcaat gtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcggcgctcccagtac tga

DBGET integrated database retrieval system