Papio anubis (olive baboon): 101025573 Help Entry 101025573         CDS       T07474                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X2   KO K05759   profilin Organism panu  Papio anubis (olive baboon) Pathway panu04015   Rap1 signaling pathway panu04810   Regulation of actin cytoskeleton panu05014   Amyotrophic lateral sclerosis panu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101025573 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101025573 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101025573 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101025573 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:panu04131]     101025573 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:panu04812]     101025573 (PFN2)    04147 Exosome [BR:panu04147]     101025573 (PFN2) Membrane trafficking [BR:panu04131]  Others   Actin-binding proteins    Others     101025573 (PFN2) Cytoskeleton proteins [BR:panu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101025573 (PFN2) Exosome [BR:panu04147]  Exosomal proteins   Proteins found in most exosomes    101025573 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101025573 NCBI-ProteinID:  XP_003895010 Ensembl:  ENSPANG00000009265 LinkDB All DBs Position 2:141946929..141953552 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat gttgctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system