Papio anubis (olive baboon): 101026060 Help Entry 101026060         CDS       T07474                                  Name (RefSeq) histone H2B type 1-N   KO K11252   histone H2B Organism panu  Papio anubis (olive baboon) Pathway panu04613   Neutrophil extracellular trap formation panu05034   Alcoholism panu05203   Viral carcinogenesis panu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:panu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101026060  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101026060   09163 Immune disease    05322 Systemic lupus erythematosus     101026060   09165 Substance dependence    05034 Alcoholism     101026060  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:panu03036]     101026060   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:panu04147]     101026060 Chromosome and associated proteins [BR:panu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101026060 Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101026060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  101026060 NCBI-ProteinID:  XP_009202892 LinkDB All DBs Position 6:27652003..27666620 Genome browser AA seq 126 aa AA seqDB search MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccctcaaagtctgctcccgccccaaagaaaggctccaagaaggcggtgaca aaggcccagaagaaggatggcaagaagcgcaagcgcagccgcaaagagagctactccgtg tacgtgtacaaggttctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg ggaatcatgaattccttcgtcaatgacatcttcgagcgcatcgcgggtgaggcttcccgc ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggctgtgcgc ctgctgctccccggggagctggccaagcacgcggtatcggagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system