Papio anubis (olive baboon): 101026253 Help Entry 101026253         CDS       T07474                                  Symbol NRAS Name (RefSeq) GTPase NRas isoform X2   KO K07828   GTPase NRas Organism panu  Papio anubis (olive baboon) Pathway panu01521   EGFR tyrosine kinase inhibitor resistance panu01522   Endocrine resistance panu04010   MAPK signaling pathway panu04012   ErbB signaling pathway panu04014   Ras signaling pathway panu04015   Rap1 signaling pathway panu04062   Chemokine signaling pathway panu04068   FoxO signaling pathway panu04071   Sphingolipid signaling pathway panu04072   Phospholipase D signaling pathway panu04137   Mitophagy - animal panu04140   Autophagy - animal panu04150   mTOR signaling pathway panu04151   PI3K-Akt signaling pathway panu04210   Apoptosis panu04211   Longevity regulating pathway panu04213   Longevity regulating pathway - multiple species panu04218   Cellular senescence panu04360   Axon guidance panu04370   VEGF signaling pathway panu04371   Apelin signaling pathway panu04540   Gap junction panu04550   Signaling pathways regulating pluripotency of stem cells panu04625   C-type lectin receptor signaling pathway panu04650   Natural killer cell mediated cytotoxicity panu04660   T cell receptor signaling pathway panu04662   B cell receptor signaling pathway panu04664   Fc epsilon RI signaling pathway panu04714   Thermogenesis panu04720   Long-term potentiation panu04722   Neurotrophin signaling pathway panu04725   Cholinergic synapse panu04726   Serotonergic synapse panu04730   Long-term depression panu04810   Regulation of actin cytoskeleton panu04910   Insulin signaling pathway panu04912   GnRH signaling pathway panu04915   Estrogen signaling pathway panu04916   Melanogenesis panu04917   Prolactin signaling pathway panu04919   Thyroid hormone signaling pathway panu04921   Oxytocin signaling pathway panu04926   Relaxin signaling pathway panu04929   GnRH secretion panu04933   AGE-RAGE signaling pathway in diabetic complications panu04935   Growth hormone synthesis, secretion and action panu05010   Alzheimer disease panu05022   Pathways of neurodegeneration - multiple diseases panu05034   Alcoholism panu05160   Hepatitis C panu05161   Hepatitis B panu05163   Human cytomegalovirus infection panu05165   Human papillomavirus infection panu05166   Human T-cell leukemia virus 1 infection panu05167   Kaposi sarcoma-associated herpesvirus infection panu05170   Human immunodeficiency virus 1 infection panu05200   Pathways in cancer panu05203   Viral carcinogenesis panu05205   Proteoglycans in cancer panu05206   MicroRNAs in cancer panu05207   Chemical carcinogenesis - receptor activation panu05208   Chemical carcinogenesis - reactive oxygen species panu05210   Colorectal cancer panu05211   Renal cell carcinoma panu05213   Endometrial cancer panu05214   Glioma panu05215   Prostate cancer panu05216   Thyroid cancer panu05218   Melanoma panu05219   Bladder cancer panu05220   Chronic myeloid leukemia panu05221   Acute myeloid leukemia panu05223   Non-small cell lung cancer panu05224   Breast cancer panu05225   Hepatocellular carcinoma panu05226   Gastric cancer panu05230   Central carbon metabolism in cancer panu05231   Choline metabolism in cancer panu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer panu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101026253 (NRAS)    04012 ErbB signaling pathway     101026253 (NRAS)    04014 Ras signaling pathway     101026253 (NRAS)    04015 Rap1 signaling pathway     101026253 (NRAS)    04370 VEGF signaling pathway     101026253 (NRAS)    04371 Apelin signaling pathway     101026253 (NRAS)    04068 FoxO signaling pathway     101026253 (NRAS)    04072 Phospholipase D signaling pathway     101026253 (NRAS)    04071 Sphingolipid signaling pathway     101026253 (NRAS)    04151 PI3K-Akt signaling pathway     101026253 (NRAS)    04150 mTOR signaling pathway     101026253 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101026253 (NRAS)    04137 Mitophagy - animal     101026253 (NRAS)   09143 Cell growth and death    04210 Apoptosis     101026253 (NRAS)    04218 Cellular senescence     101026253 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     101026253 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     101026253 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101026253 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101026253 (NRAS)    04650 Natural killer cell mediated cytotoxicity     101026253 (NRAS)    04660 T cell receptor signaling pathway     101026253 (NRAS)    04662 B cell receptor signaling pathway     101026253 (NRAS)    04664 Fc epsilon RI signaling pathway     101026253 (NRAS)    04062 Chemokine signaling pathway     101026253 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     101026253 (NRAS)    04929 GnRH secretion     101026253 (NRAS)    04912 GnRH signaling pathway     101026253 (NRAS)    04915 Estrogen signaling pathway     101026253 (NRAS)    04917 Prolactin signaling pathway     101026253 (NRAS)    04921 Oxytocin signaling pathway     101026253 (NRAS)    04926 Relaxin signaling pathway     101026253 (NRAS)    04935 Growth hormone synthesis, secretion and action     101026253 (NRAS)    04919 Thyroid hormone signaling pathway     101026253 (NRAS)    04916 Melanogenesis     101026253 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     101026253 (NRAS)    04726 Serotonergic synapse     101026253 (NRAS)    04720 Long-term potentiation     101026253 (NRAS)    04730 Long-term depression     101026253 (NRAS)    04722 Neurotrophin signaling pathway     101026253 (NRAS)   09158 Development and regeneration    04360 Axon guidance     101026253 (NRAS)   09149 Aging    04211 Longevity regulating pathway     101026253 (NRAS)    04213 Longevity regulating pathway - multiple species     101026253 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     101026253 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101026253 (NRAS)    05206 MicroRNAs in cancer     101026253 (NRAS)    05205 Proteoglycans in cancer     101026253 (NRAS)    05207 Chemical carcinogenesis - receptor activation     101026253 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     101026253 (NRAS)    05203 Viral carcinogenesis     101026253 (NRAS)    05230 Central carbon metabolism in cancer     101026253 (NRAS)    05231 Choline metabolism in cancer     101026253 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101026253 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     101026253 (NRAS)    05225 Hepatocellular carcinoma     101026253 (NRAS)    05226 Gastric cancer     101026253 (NRAS)    05214 Glioma     101026253 (NRAS)    05216 Thyroid cancer     101026253 (NRAS)    05221 Acute myeloid leukemia     101026253 (NRAS)    05220 Chronic myeloid leukemia     101026253 (NRAS)    05218 Melanoma     101026253 (NRAS)    05211 Renal cell carcinoma     101026253 (NRAS)    05219 Bladder cancer     101026253 (NRAS)    05215 Prostate cancer     101026253 (NRAS)    05213 Endometrial cancer     101026253 (NRAS)    05224 Breast cancer     101026253 (NRAS)    05223 Non-small cell lung cancer     101026253 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101026253 (NRAS)    05170 Human immunodeficiency virus 1 infection     101026253 (NRAS)    05161 Hepatitis B     101026253 (NRAS)    05160 Hepatitis C     101026253 (NRAS)    05163 Human cytomegalovirus infection     101026253 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     101026253 (NRAS)    05165 Human papillomavirus infection     101026253 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     101026253 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     101026253 (NRAS)   09165 Substance dependence    05034 Alcoholism     101026253 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101026253 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101026253 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101026253 (NRAS)    01522 Endocrine resistance     101026253 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:panu04131]     101026253 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:panu04147]     101026253 (NRAS)    04031 GTP-binding proteins [BR:panu04031]     101026253 (NRAS) Membrane trafficking [BR:panu04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     101026253 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     101026253 (NRAS) Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101026253 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    101026253 (NRAS)   Exosomal proteins of breast cancer cells    101026253 (NRAS)   Exosomal proteins of colorectal cancer cells    101026253 (NRAS) GTP-binding proteins [BR:panu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101026253 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  101026253 NCBI-ProteinID:  XP_009214263 Ensembl:  ENSPANG00000008181 LinkDB All DBs Position 1:complement(113050958..113064039) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac agaaaacaggtggttatagatggtgaaacctgtttgttggacatactggatacagctgga caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt aagcgagtaaaagactcggatgatgtacctatggtgctagtgggaaacaagtgtgatttg ccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt tgtatgggattaccatgtgtggtgatgtaa

DBGET integrated database retrieval system