Papio anubis (olive baboon): 103878847 Help Entry 103878847         CDS       T07474                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism panu  Papio anubis (olive baboon) Pathway panu04014   Ras signaling pathway panu04137   Mitophagy - animal panu04144   Endocytosis panu04145   Phagosome panu04148   Efferocytosis panu04962   Vasopressin-regulated water reabsorption panu05132   Salmonella infection panu05146   Amoebiasis panu05152   Tuberculosis Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103878847 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103878847 (RAB5C)    04145 Phagosome     103878847 (RAB5C)    04137 Mitophagy - animal     103878847 (RAB5C)    04148 Efferocytosis     103878847 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     103878847 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103878847 (RAB5C)    05152 Tuberculosis     103878847 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     103878847 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:panu04131]     103878847 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:panu04147]     103878847 (RAB5C)    04031 GTP-binding proteins [BR:panu04031]     103878847 (RAB5C) Membrane trafficking [BR:panu04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     103878847 (RAB5C)  Endosome - Lysosome transport     103878847 (RAB5C) Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103878847 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    103878847 (RAB5C)   Exosomal proteins of colorectal cancer cells    103878847 (RAB5C)   Exosomal proteins of bladder cancer cells    103878847 (RAB5C) GTP-binding proteins [BR:panu04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     103878847 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  103878847 NCBI-ProteinID:  XP_009188926 Ensembl:  ENSPANG00000021454 LinkDB All DBs Position 17:complement(49301187..49332091) Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggcgcagcacgacccaatggaccagccgctgggaacaagatctgt cagtttaagctggttctgctgggggagtctgcggtgggcaaatccagcctcgtcctccgc tttgtcaagggacagtttcacgagtaccaggagagcacaatcggagcggccttcctcaca cagactgtctgcctggatgacacaacagtcaagtttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggctcaggctgccatcgtggtc tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctacag aggcaggccagccccaacatcgtcattgcactcgcgggtaacaaggcagacctggccagc aagagagctgtggaattccaggaagcacaagcctatgcagatgacaacagtttgctgttc atggagacatcagcaaagactgcaatgaacgtgaacgaaatcttcatggcaatagctaag aagcttcccaagaacgagccccagaatgcaactggtgctccaggccgaaaccgaggtgtg gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system