Pantoea sp. SOD02: NR302_04650
Help
Entry
NR302_04650 CDS
T10895
Name
(GenBank) SDR family oxidoreductase
Organism
panz Pantoea sp. SOD02
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
SDR
3HCDH_N
Epimerase
DUF1776
Motif
Other DBs
NCBI-ProteinID:
UVC30263
LinkDB
All DBs
Position
1023378..1024109
Genome browser
AA seq
243 aa
AA seq
DB search
MSRLDNKVAVVLGGAKGIGLAISQRFASEGATTWFTSRREEELQAASSSITGNAHPLRAD
VSQQSELTRIIETIRRESGQLDVLVINAGMAEYATIDEISAGHFDQIFGLNVRSPVFALQ
AALPLLKPGASVVLMGSIADVIGTQGYGVYSASKAALRSFARTWTRELSARGIRINVVAP
GPIDTDMMQAASEEVRNGITSTIPLSRMGKPEEVANVALFLASDESSYIAGAEFCVDGGL
TQV
NT seq
732 nt
NT seq
+upstream
nt +downstream
nt
atgagcagactggataacaaagtggcggtggtgctgggcggcgcaaagggaattggtctg
gcgatcagccagcgtttcgccagtgagggcgcgacaacctggtttacttcgcgccgcgaa
gaagagttacaggccgccagcagcagcatcaccggcaacgcgcatccgctgcgtgccgac
gtgagccagcagagtgaactaacgcgcattatcgagacgatcaggcgcgaatccggccag
ctggatgtgttggtaatcaacgctggcatggcggagtacgccaccattgatgagattagc
gccgggcattttgaccaaatcttcggccttaatgtgcgctcgccggtgtttgccttgcag
gcagcattgccactgctgaagcccggcgccagcgtggtattgatgggttcgattgccgat
gtgattggcacccagggttacggcgtttacagcgccagcaaagccgcgctgcgatccttt
gcccgcacctggacgcgcgagctctccgcgcgcggcatccgtattaatgtggtggcgccc
ggccccatcgataccgatatgatgcaggcggcttctgaagaggtgcgcaacggcatcacc
agcactattccgctcagcagaatgggcaaacccgaagaagtggccaacgtcgcgctgttc
ctcgccagtgacgagagcagctacattgcaggcgcagaattctgtgtggatggcggtttg
acgcaggtgtga
DBGET
integrated database retrieval system