Pantoea sp. SOD02: NR302_07680 Help Entry NR302_07680       CDS       T10895                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism panz  Pantoea sp. SOD02 Pathway panz00998   Biosynthesis of various antibiotics panz01100   Metabolic pathways panz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:panz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NR302_07680 (acpP)    00074 Mycolic acid biosynthesis     NR302_07680 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NR302_07680 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 NirdL-like_HTH HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UVC30819 LinkDB All DBs Position 1654172..1654411 Genome browser AA seq 79 aa AA seqDB search MSDIEQRVKKIVAEQLGVKEDEVINTASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINSHKHD NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaacaacgcgttaagaaaatcgtagctgagcagctgggtgttaaagaa gacgaagtgattaacactgcttctttcgttgaagaccttggtgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgaaattccagacgaagaagct gagaaaatcactaccgttcaggcagcgatcgattacatcaatagtcataaacacgactaa

DBGET integrated database retrieval system