Pantoea sp. At-9b: Pat9b_1451 Help Entry Pat9b_1451        CDS       T01386                                  Name (GenBank) DinI family protein   KO K12149   DNA-damage-inducible protein I Organism pao  Pantoea sp. At-9b Brite KEGG Orthology (KO) [BR:pao00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pao03400]     Pat9b_1451 DNA repair and recombination proteins [BR:pao03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     Pat9b_1451 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Kelch_KLHDC2_KLHL20_DRC7 DUF5374 Motif Other DBs NCBI-ProteinID:  ADU68768 UniProt:  E6WDE6 LinkDB All DBs Position complement(1627081..1627326) Genome browser AA seq 81 aa AA seqDB search MRVEITVAKTQPLPAGALDALSAELTRRISRDFPDDEHHVKVRYASGNQLSVFGGCKENR ERISDILQETWESADDWFITD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtgttgaaattaccgtagcaaaaactcagccccttcctgcgggcgccctggatgcg ctaagcgcagagcttacccgccgcatctcccgagatttcccagacgacgaacatcatgtc aaagtccgctatgccagcggcaatcaactcagcgtgtttggtggttgcaaagagaatcgc gaacgtatcagcgatattttgcaggaaacctgggaaagcgctgacgactggtttattacc gattaa

DBGET integrated database retrieval system