Pantoea sp. At-9b: Pat9b_1483 Help Entry Pat9b_1483        CDS       T01386                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pao  Pantoea sp. At-9b Pathway pao01100   Metabolic pathways pao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pat9b_1483   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pat9b_1483 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 TerB HLH DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ADU68800 UniProt:  E6W836 LinkDB All DBs Position 1657142..1657378 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIIEQLGVKPEEVTHAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYITSHQG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactattgaggaaagagttaagaagatcatcatcgagcagttgggcgttaaaccg gaagaagtgacccacgctgcttctttcgttgacgacctgggtgctgattctcttgacacc gttgaactggttatggctctggaagaagagttcgataccgaaattccagacgaagaagct gagaaaatcactaccgttcaggcagcgatcgactacatcactagccaccaaggctaa

DBGET integrated database retrieval system