Pantoea sp. At-9b: Pat9b_1702 Help Entry Pat9b_1702        CDS       T01386                                  Name (GenBank) putative acyl-carrier protein   KO K02078   acyl carrier protein Organism pao  Pantoea sp. At-9b Pathway pao01100   Metabolic pathways pao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pat9b_1702    00074 Mycolic acid biosynthesis     Pat9b_1702   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pat9b_1702 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADU69018 UniProt:  E6WDJ3 LinkDB All DBs Position 1886443..1886718 Genome browser AA seq 91 aa AA seqDB search MMQEDIEARKAVLLTIKTEIIQRLHIQKNAAQIDDDTPLFGNGLKLDSVDATEILVLLDK TFGIQVSEGQDPSYMRSINTLASFVLKNRKH NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgatgcaagaagatattgaagcgcgcaaagcggtgttgctcaccattaaaacggaaatc attcagcgtctgcatatacagaagaatgcagcgcagattgatgatgatacgcccttgttt ggcaatggacttaaactggattcagtcgatgctacggaaattctggtattactggataag acttttggtattcaggtcagtgaaggtcaagacccatcttatatgcgaagcatcaacacg ttggcctcatttgtgttgaaaaacagaaagcattaa

DBGET integrated database retrieval system