Pantoea sp. At-9b: Pat9b_2104 Help Entry Pat9b_2104        CDS       T01386                                  Name (GenBank) DinI family protein   KO K12149   DNA-damage-inducible protein I Organism pao  Pantoea sp. At-9b Brite KEGG Orthology (KO) [BR:pao00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pao03400]     Pat9b_2104 DNA repair and recombination proteins [BR:pao03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     Pat9b_2104 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI NonGDSL Motif Other DBs NCBI-ProteinID:  ADU69416 LinkDB All DBs Position 2320756..2320914 Genome browser AA seq 52 aa AA seqDB search MIVEVKIAKEKAGKMPKGAMDALQVELTKRLSRSYPDLNVVVKTASNDGLSV NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atgattgttgaagtgaagattgcgaaagagaaagcagggaaaatgccgaaaggtgcaatg gatgcgctgcaggtggaactgacaaagcgactcagccggagctatcccgatctgaatgtc gtagtgaagaccgccagtaatgacggactgtcagtatga

DBGET integrated database retrieval system