KEGG   Pantoea sp. At-9b: Pat9b_2723
Entry
Pat9b_2723        CDS       T01386                                 
Name
(GenBank) NADH-ubiquinone/plastoquinone oxidoreductase chain 6
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00190  Oxidative phosphorylation
pao01100  Metabolic pathways
Module
pao_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pao00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Pat9b_2723
Enzymes [BR:pao01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     Pat9b_2723
SSDB
Motif
Pfam: Oxidored_q3 AA_permease_2 TRAP_alpha DUF2109
Other DBs
NCBI-ProteinID: ADU70023
LinkDB
Position
complement(2990546..2991097)
AA seq 183 aa
MEFAFYLCGLVAVLTTLRVITHTNPVHALLYLIVSLLSIAGVFFSMGAYFAGALEIIVYA
GAIMVLFVFVVMMLNLGKSQQDQEREWLKPSLWIGPGIVSLLLLVVMIYAISTAHDQGID
GTVIDAKAVGISLFGPYVLAVELASMLLLAGLVVAFHIGREERQGEVLSNRPAEAQGNKE
EHA
NT seq 552 nt   +upstreamnt  +downstreamnt
atggaatttgcgttttatctttgcggtctggtggcggtgttgacgacgcttcgcgttatc
acccataccaatccggtacatgcgctgctgtatctgattgtttcgctgctgtcgattgct
ggcgtcttcttctccatgggcgcttactttgccggtgcgctggaaatcatcgtctatgct
ggcgcgattatggtgttgttcgtgttcgtggtgatgatgctgaacctcggcaaatctcaa
caggatcaggagcgtgaatggctgaagccgtcgctgtggattggtcctggcatcgtttcc
ctgctgctgttggtggtgatgatttatgccatcagcaccgcgcacgatcaggggattgat
ggcacggtcatcgatgccaaagcggtgggtatcagcctgtttggtccttacgtactggcg
gtggagctggcatcgatgctgctgctggccggtctggttgttgccttccatattggacgt
gaagagcgtcagggcgaggtgttaagcaatcgcccggcagaggcgcaagggaataaggag
gagcacgcatga

DBGET integrated database retrieval system