Pantoea sp. At-9b: Pat9b_3905
Help
Entry
Pat9b_3905 CDS
T01386
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
pao
Pantoea sp. At-9b
Pathway
pao00770
Pantothenate and CoA biosynthesis
pao01100
Metabolic pathways
pao01240
Biosynthesis of cofactors
Module
pao_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
pao00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
Pat9b_3905
Enzymes [BR:
pao01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
Pat9b_3905
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
ADU71195
LinkDB
All DBs
Position
4265464..4265949
Genome browser
AA seq
161 aa
AA seq
DB search
MSTKAIYPGTFDPITLGHLDIVTRAARMFDHIVLAIAASPSKKPLFSLDERVDLARQVTA
HLGNVEVIGFSDLMANFAQAQQANVLVRGLRAVSDFEYELQLAHMNRHLLPDLESVFLMP
SEGFSFVSSSLVKEVARHQGDVQAFLPAVVHQALLSKLAQP
NT seq
486 nt
NT seq
+upstream
nt +downstream
nt
atgagtaccaaagcgatttatcccggcacctttgatcccatcaccctcggtcatctggat
atcgtcacgcgggcggcgaggatgtttgaccacattgtgttggcgattgctgccagtccg
agcaaaaagccgctgttcagcctggatgaacgggttgatttggcgcgtcaggtcaccgcg
catttggggaatgtcgaggtgatcggcttcagtgacttgatggcgaatttcgcccaagcc
cagcaggccaacgtgttggtacgcggcctgcgtgccgtatcggatttcgaatatgagcta
caactggcgcatatgaatcgtcatctgctgcctgacctcgaaagcgtgtttctgatgcca
tccgaaggcttctcatttgtttcatcttcgctggtcaaagaagtggcgcgtcaccagggc
gacgtgcaggcattcctgcctgccgtggtccatcaggcgctgctgagcaagctggcgcag
ccttaa
DBGET
integrated database retrieval system