Pseudomonas paraeruginosa PA7: PSPA7_2195 Help Entry PSPA7_2195        CDS       T00569                                  Symbol acpP2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pap  Pseudomonas paraeruginosa PA7 Pathway pap01100   Metabolic pathways pap01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pap00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PSPA7_2195 (acpP2)    00074 Mycolic acid biosynthesis     PSPA7_2195 (acpP2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PSPA7_2195 (acpP2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 TerB Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ABR81030 UniProt:  A6V3D2 LinkDB All DBs Position 2250002..2250238 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEKA EKITTVQEAIDYIVAHQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgttaagaagatcgtcgctgaacaactcggcgtgaaggaa gaagaagtcaccaacagcgcttccttcgtcgaagacctgggcgccgactcccttgacacc gtcgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgagaaagct gaaaagatcaccaccgttcaggaagccatcgactacatcgttgctcaccagcagtaa

DBGET integrated database retrieval system