Pseudomonas paraeruginosa PA7: PSPA7_5969 Help Entry PSPA7_5969        CDS       T00569                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism pap  Pseudomonas paraeruginosa PA7 Brite KEGG Orthology (KO) [BR:pap00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pap03036]     PSPA7_5969 Chromosome and associated proteins [BR:pap03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PSPA7_5969 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB HALZ APC_N_CC DUF7491 Matrilin_ccoil TSC22 LicD Motif Other DBs NCBI-ProteinID:  ABR82653 UniProt:  A6VE00 LinkDB All DBs Position 6165875..6166084 Genome browser AA seq 69 aa AA seqDB search MEDADLQLLTAKFDQLLQKLEQLKAENRLLRANEKSWREERAHLIEKNEMARHKVEAMIL RLKALEQDT NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacgccgatctgcaactgttgacggccaagttcgaccagctgctccagaagctg gaacagctcaaggcggagaaccggctgctgcgggcgaacgaaaagtcctggcgcgaagag cgcgctcatctgatcgaaaagaacgaaatggcgagacacaaggtcgaagcgatgattttg cgtctgaaagccttggagcaggacacatga

DBGET integrated database retrieval system