Pandoraea apista: SG18_14160 Help Entry SG18_14160        CDS       T03588                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism papi  Pandoraea apista Pathway papi02020   Two-component system papi02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:papi00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     SG18_14160  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     SG18_14160  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:papi02035]     SG18_14160 Bacterial motility proteins [BR:papi02035]  Flagellar system   Flagellar assembly proteins    Others     SG18_14160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  AJE99044 LinkDB All DBs Position 5110362..5110661 Genome browser AA seq 99 aa AA seqDB search MPKIDSIANVAPIDAARLRLTAGQTQPPAKPTAAMGSTPRAVPANAGEWLASARAAVESV PRVDAAKVARIKAMLASGELAFDSERVANGILAHHGMLR NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgcccaagatcgactcgattgccaacgtcgcgcccatcgacgccgcgcgcctgcgcctg acggcggggcagacccagccgccggcgaagccgacggctgctatgggtagcactccacgt gcggtgccggcgaacgccggcgaatggcttgccagcgcgcgcgctgccgtcgagtccgtg ccgcgcgtggacgccgccaaggtcgcccgaatcaaggcgatgctggcgagcggtgagttg gccttcgacagcgagcgcgtggcgaacgggatactcgcgcatcacgggatgttgcgttga

DBGET integrated database retrieval system