Pandoraea apista: SG18_14270 Help Entry SG18_14270        CDS       T03588                                  Name (GenBank) hypothetical protein   KO K02408   flagellar hook-basal body complex protein FliE Organism papi  Pandoraea apista Pathway papi02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:papi00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     SG18_14270  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:papi02035]     SG18_14270 Bacterial motility proteins [BR:papi02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     SG18_14270 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FliE SKIP24_C Motif Other DBs NCBI-ProteinID:  AJF01036 LinkDB All DBs Position 5129596..5129916 Genome browser AA seq 106 aa AA seqDB search MEQSLMTEMRRMQATQRELNMAAGVREAEPALAGPSGKPDFSAMLRGVDAAQRDAGDRMQ AVDLGQSDDLTGAMLASAQADLSFSMLMRTRDKVVGAVEELVRMPF NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggaacagtcgctgatgactgaaatgcgtcgcatgcaagcgacgcaacgcgaactgaat atggccgctggtgtgcgcgaggccgagcctgcactggcaggcccctcgggcaagcccgat ttcagcgcgatgctgcgcggggtcgatgccgctcagcgcgacgcgggcgaccgtatgcag gccgtcgatctgggccagagcgacgatctgaccggtgcgatgctggcaagcgcgcaggcc gacctgtcgttttccatgctgatgcgcacgcgcgacaaggtggtaggcgcggtggaagag ttggtgcgtatgccgttctga

DBGET integrated database retrieval system