Pantoea ananatis PA13: PAGR_g2838 Help Entry PAGR_g2838        CDS       T01970                                  Name (GenBank) glutaredoxin-1 GrxA   KO K03674   glutaredoxin 1 Organism paq  Pantoea ananatis PA13 Brite KEGG Orthology (KO) [BR:paq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:paq03110]     PAGR_g2838 Chaperones and folding catalysts [BR:paq03110]  Protein folding catalysts   Protein disulfide isomerase    PAGR_g2838 SSDB OrthologParalogGFIT Motif Pfam:  Glutaredoxin Glrx-like MDH1B_N Thioredoxin_2 SH3BGR Thioredoxin_3 GST_N_3 Motif Other DBs NCBI-ProteinID:  AER33336 LinkDB All DBs Position 3073708..3073971 Genome browser AA seq 87 aa AA seqDB search MIAVIFGRPGCPYCVRAKELADKLQAGRDDFNYQYVDIQAEGITKADLEASAGKPVSTVP QIFLDEQHIGGYTEFAAWTKENLGFVA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgattgctgttatttttggtcgtcccggctgcccttactgtgttcgggcgaaagaactg gcggataagctgcaggccgggcgtgacgatttcaattaccagtatgttgatattcaggcg gaaggcatcactaaagccgatctggaagccagtgcaggtaaacctgtcagcaccgtaccg cagatttttctggatgagcagcatattggtggctacaccgaattcgccgcctggacaaaa gagaatctgggatttgttgcctga

DBGET integrated database retrieval system