Paraburkholderia sp. SOS3: BTO02_00675 Help Entry BTO02_00675       CDS       T04966                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism para  Paraburkholderia sp. SOS3 Brite KEGG Orthology (KO) [BR:para00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:para03032]     BTO02_00675    03036 Chromosome and associated proteins [BR:para03036]     BTO02_00675    03400 DNA repair and recombination proteins [BR:para03400]     BTO02_00675 DNA replication proteins [BR:para03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BTO02_00675 Chromosome and associated proteins [BR:para03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BTO02_00675 DNA repair and recombination proteins [BR:para03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BTO02_00675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF937 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  APR34162 UniProt:  A0A1L6HRQ3 LinkDB All DBs Position 1:154392..154670 Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAGQTGASKAQTGETLDTLLEVIKKAVSKGDSVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgcagggcagacgggcgccagcaaggctcaa accggcgaaacgctggacacgctcctcgaagtaatcaagaaggcagtgtcgaagggtgac tcagttcagttgatcggctttggcagcttcggttcgggcaagcgcgcagcacgtacgggc cgcaacccgaagaccggcgaaaccatcaagattccggccgccaagacggtcaagttcacg gccggtaaggcattcaaggacgcagtcaacaagcgttga

DBGET integrated database retrieval system