Paraburkholderia sp. SOS3: BTO02_01555 Help Entry BTO02_01555       CDS       T04966                                  Name (GenBank) H-NS histone   KO K03746   DNA-binding protein H-NS Organism para  Paraburkholderia sp. SOS3 Brite KEGG Orthology (KO) [BR:para00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:para03036]     BTO02_01555    03400 DNA repair and recombination proteins [BR:para03400]     BTO02_01555 Chromosome and associated proteins [BR:para03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BTO02_01555 DNA repair and recombination proteins [BR:para03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BTO02_01555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Topoisom_I_N Ocnus DUF7307 MAGE Motif Other DBs NCBI-ProteinID:  APR34307 UniProt:  A0A1L6HS65 LinkDB All DBs Position 1:349043..349345 Genome browser AA seq 100 aa AA seqDB search MSSYKELLAQREKLEKQIEEAKAREYAEVLNEIKQKMSDYGITLAELGGGRGAKNAKAGR VRTGVAPKYRDPDSGNTWSGRGKPPRWIAGQDREKFLIQK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgtcttcctacaaagaactcctcgcgcagcgcgagaagcttgaaaaacagatcgaagag gcgaaggcgcgtgaatatgccgaagtgctgaacgaaatcaagcagaagatgtccgactac ggcattacgctcgcggaactcggcggcggccgaggtgcgaagaatgcgaaagccgggcgt gtccgcacgggcgtcgcgccgaagtatcgcgatcctgatagcggcaatacatggtcgggc cgcggcaaaccgccgcgttggatcgccggccaggatcgcgaaaagtttctgatccagaaa taa

DBGET integrated database retrieval system