Paraburkholderia sp. SOS3: BTO02_15250 Help Entry BTO02_15250       CDS       T04966                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism para  Paraburkholderia sp. SOS3 Pathway para00998   Biosynthesis of various antibiotics para01100   Metabolic pathways para01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:para00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BTO02_15250    00074 Mycolic acid biosynthesis     BTO02_15250   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BTO02_15250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  APR36544 UniProt:  A0A1L6HZ91 LinkDB All DBs Position 1:complement(3416130..3416369) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgttaagaagatcgttgcggaacaactgggcgtcgccgaa gcggaaatcaagaacgaagcctcgttcgtcaacgatctcggcgctgattcgctcgatacc gtcgaactcgtgatggccctcgaagacgaattcggcatggaaattccggatgaagaagcc gagaagatcaccacggtgcagcaagcgatcgactacgctcgcgccaacgtcaaggcctaa

DBGET integrated database retrieval system