Paraburkholderia sp. SOS3: BTO02_15945 Help Entry BTO02_15945       CDS       T04966                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism para  Paraburkholderia sp. SOS3 Pathway para00998   Biosynthesis of various antibiotics para01100   Metabolic pathways para01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:para00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BTO02_15945    00074 Mycolic acid biosynthesis     BTO02_15945   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BTO02_15945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB Motif Other DBs NCBI-ProteinID:  APR36653 LinkDB All DBs Position 1:complement(3570522..3570773) Genome browser AA seq 83 aa AA seqDB search MTDAEILARIRAIFNENFAIDPERVTPEAHLFEDLDLDSIDAVDLAIKLQEMTGRRIKPE EFKSVRTVGDVIVAVESLLAAQG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgaccgacgcagaaatcctcgcgcgcatccgcgcgatcttcaacgagaacttcgccatc gatcccgaacgcgtgacgcccgaggcgcatctgttcgaggacctcgatctcgacagcatc gacgcggtcgatctcgcgatcaagctgcaggaaatgactggccgccgcatcaagccggaa gaattcaagtcggtgcgcacagtgggcgatgtgatcgttgccgtcgagtcgctgctcgcg gcgcagggctga

DBGET integrated database retrieval system