Paraburkholderia sp. SOS3: BTO02_31080 Help Entry BTO02_31080       CDS       T04966                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism para  Paraburkholderia sp. SOS3 Brite KEGG Orthology (KO) [BR:para00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:para03110]     BTO02_31080 Chaperones and folding catalysts [BR:para03110]  Protein folding catalysts   Protein disulfide isomerase    BTO02_31080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_3 Thioredoxin_3 GST_N_2 SH3BGR GST_N Motif Other DBs NCBI-ProteinID:  APR40403 UniProt:  A0A1L6I9L3 LinkDB All DBs Position 2:complement(2475454..2475714) Genome browser AA seq 86 aa AA seqDB search MPEITLYTKPTCPYCLAAKALLRGKGAAFREIDIENNRAKTLEMIERSGRRTVPQIYVGG THVGGYDDLRALENEGGLDALLTARV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaatcacgctctatacgaagccgacgtgcccgtactgtcttgccgcgaaagcg ctgctgcgcggcaagggtgccgcgttccgcgaaatcgacatcgagaacaaccgggcgaag acgctcgagatgatcgagcgcagcggacgccgcacggtgccgcagatctatgtaggcggg acgcacgtgggcggctacgacgatctgcgtgcgctcgagaacgaaggcggtctcgacgcg ctgttgacggcgagggtttga

DBGET integrated database retrieval system