Paraburkholderia aromaticivorans: CJU94_05695 Help Entry CJU94_05695       CDS       T05169                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism parb  Paraburkholderia aromaticivorans Pathway parb00190   Oxidative phosphorylation parb01100   Metabolic pathways Module parb_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:parb00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CJU94_05695  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:parb00194]     CJU94_05695 Photosynthesis proteins [BR:parb00194]  Photosystem and electron transport system   F-type ATPase [OT]    CJU94_05695 SSDB OrthologParalogGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  ASV97702 UniProt:  A0A248VFP3 LinkDB All DBs Position 1:1263134..1263403 Genome browser AA seq 89 aa AA seqDB search MQAFIANIQGLTAIGIGIIIGLGAIGACIGIGLMGGKYIEACARQPELMNPLQTKMFLLA GLIDAAFLIGVGVAMLFAFANPLLSKLAG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcaagctttcatcgccaacatccagggtctgaccgccatcggtatcggcatcatcatc ggcctgggtgcaatcggcgcctgtatcggtatcggcctgatgggcggcaagtacatcgaa gcatgtgcacgtcagcctgagctgatgaacccgctgcaaaccaagatgttcctgctggct ggtctgatcgatgcggcgttcctgattggcgttggtgtggcaatgctgtttgcgttcgcg aacccgctgctgtcgaagctggcaggctga

DBGET integrated database retrieval system