Paraburkholderia aromaticivorans: CJU94_10395 Help Entry CJU94_10395       CDS       T05169                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism parb  Paraburkholderia aromaticivorans Pathway parb00998   Biosynthesis of various antibiotics parb01100   Metabolic pathways parb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:parb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CJU94_10395    00074 Mycolic acid biosynthesis     CJU94_10395   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CJU94_10395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  ASV98550 UniProt:  A0A248VHT9 LinkDB All DBs Position 1:2257676..2257915 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacagcgcgtcaagaagatcgtcgcagaacaactgggcgttgcagaa gctgagatcaagaacgaagcttcgttcgtgaacgacctcggcgccgactcgctcgacacc gttgaactcgtgatggccctcgaagacgagttcggcatggaaattccggatgaagaagcc gagaagatcaccaccgttcagcaagcaatcgactacgctcgcgcgaacgtcaaggcctaa

DBGET integrated database retrieval system