Paraburkholderia aromaticivorans: CJU94_38065 Help Entry CJU94_38065       CDS       T05169                                  Name (GenBank) phenol hydroxylase   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism parb  Paraburkholderia aromaticivorans Pathway parb00361   Chlorocyclohexane and chlorobenzene degradation parb00362   Benzoate degradation parb00623   Toluene degradation parb01100   Metabolic pathways parb01120   Microbial metabolism in diverse environments parb01220   Degradation of aromatic compounds Module parb_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:parb00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CJU94_38065    00361 Chlorocyclohexane and chlorobenzene degradation     CJU94_38065    00623 Toluene degradation     CJU94_38065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_hyd_sub Motif Other DBs NCBI-ProteinID:  ASW04102 UniProt:  A0A248W020 LinkDB All DBs Position pBN2:370021..370245 Genome browser AA seq 74 aa AA seqDB search MHKQAALEAEPGFDPNLRFVSVTAINTQGFVQFEFSVGTPELCVELMLPVAAFEEFCLAQ KVTRLDAFGEIVRH NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgcacaagcaagcagcccttgaggcggaacccgggttcgatccgaacctcaggtttgtc agcgttaccgccatcaacacacagggattcgtccagttcgaattttcagtcggcaccccc gagctctgtgtcgagctcatgctgcccgttgctgcgttcgaagaattttgcctcgcgcag aaggtgacgcgattggatgccttcggcgagattgtgcggcattga

DBGET integrated database retrieval system