Paraburkholderia aromaticivorans: CJU94_38075 Help Entry CJU94_38075       CDS       T05169                                  Name (GenBank) monooxygenase   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism parb  Paraburkholderia aromaticivorans Pathway parb00361   Chlorocyclohexane and chlorobenzene degradation parb00362   Benzoate degradation parb00623   Toluene degradation parb01100   Metabolic pathways parb01120   Microbial metabolism in diverse environments parb01220   Degradation of aromatic compounds Module parb_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:parb00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CJU94_38075    00361 Chlorocyclohexane and chlorobenzene degradation     CJU94_38075    00623 Toluene degradation     CJU94_38075 Enzymes [BR:parb01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      CJU94_38075     1.14.13.244  phenol 2-monooxygenase (NADH)      CJU94_38075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Ubiquitin_5 Motif Other DBs NCBI-ProteinID:  ASW03960 UniProt:  A0A248W003 LinkDB All DBs Position pBN2:371368..371637 Genome browser AA seq 89 aa AA seqDB search MSNVFIAFQANEESRPVVEAILADNPNAVATESPGMVKIDAPGHLTINRQSIEDRIGMKF DLQQIHINLITLSGYIDEDDEQFTLSWKH NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctaacgtatttatcgcgtttcaggctaacgaggagtctcgaccggtggtggaggcg attctcgctgataaccctaatgcggtcgccacagaatcgcctggcatggtgaagatcgat gcgcccgggcatctcacaataaaccgtcaaagcatcgaagaccggatcggcatgaagttc gatctccagcaaatccacatcaacctgatcaccttgtccggatatatcgacgaggatgac gaacagttcacgctgagctggaaacactga

DBGET integrated database retrieval system