Parageobacillus sp. KH3-4: PspKH34_35760 Help Entry PspKH34_35760     CDS       T08468                                  Symbol groS Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism parg  Parageobacillus sp. KH3-4 Brite KEGG Orthology (KO) [BR:parg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:parg03110]     PspKH34_35760 (groS)    03029 Mitochondrial biogenesis [BR:parg03029]     PspKH34_35760 (groS) Chaperones and folding catalysts [BR:parg03110]  Heat shock proteins   HSP10    PspKH34_35760 (groS) Mitochondrial biogenesis [BR:parg03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     PspKH34_35760 (groS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  BDG49015 LinkDB All DBs Position complement(3561749..3562033) Genome browser AA seq 94 aa AA seqDB search MLKPLGDRVVIEIVETEEKTASGIVLPDTAKEKPQEGKVVAVGKGRVLDNGQRVAPEVEV GDRIIFSKYAGTEVKYDGKEYLILRESDILAVIG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt gtgttaaagccattaggtgatcgcgttgtcattgaaatcgttgaaacggaagaaaaaact gcaagcggtatcgtattgccagatactgcgaaagaaaaaccacaagaaggtaaagttgtt gccgttggaaaaggacgcgtgcttgacaacggtcaacgtgtagctccagaagtggaagtt ggcgatcgcattatcttttcgaaatatgcgggtacagaagtgaaatatgacggcaaagaa tacttaattttgcgtgaaagcgatattttggctgttattggttaa

DBGET integrated database retrieval system