Priestia aryabhattai: I5S86_08480 Help Entry I5S86_08480       CDS       T07135                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism parh  Priestia aryabhattai Pathway parh00998   Biosynthesis of various antibiotics parh01100   Metabolic pathways parh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:parh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I5S86_08480 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I5S86_08480 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QPN46913 LinkDB All DBs Position 1866224..1866460 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEIKNESSFVDDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVNAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgtcaaggaa gaggaaatcaagaacgaatcttctttcgttgatgatctgggtgccgactcgcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcc gagaagatcactaccgttcaagctgccatcgactacgtcaacgcccaccaggcttaa

DBGET integrated database retrieval system