Pectobacterium aroidearum: I2D83_13410 Help Entry I2D83_13410       CDS       T07244                                  Symbol dinI Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism pari  Pectobacterium aroidearum Brite KEGG Orthology (KO) [BR:pari00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pari03400]     I2D83_13410 (dinI) DNA repair and recombination proteins [BR:pari03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     I2D83_13410 (dinI) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI RWD Motif Other DBs NCBI-ProteinID:  QPI41494 LinkDB All DBs Position 2999592..2999831 Genome browser AA seq 79 aa AA seqDB search MRVEITLAKTTPLPAGAIDALRHELEKRIHKIYPDTPIQVRYASANNLTVMGAGKDDKDR ISEILQETWESADDWFTAE NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgcgcgtagaaatcactcttgcaaagacaacgcctttacccgccggtgcgattgatgca ctcaggcatgagctggaaaaacgtattcacaaaatttatcccgatacgcccattcaggtt cgttatgcatctgcaaataacctgacggtaatgggtgcaggcaaagatgacaaagatcgt atctctgaaattttgcaggaaacgtgggaaagtgccgacgactggtttacagcagagtaa

DBGET integrated database retrieval system