Parasphingorhabdus cellanae: J4G78_01925 Help Entry J4G78_01925       CDS       T07111                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism parj  Parasphingorhabdus cellanae Pathway parj01100   Metabolic pathways parj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:parj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J4G78_01925    00074 Mycolic acid biosynthesis     J4G78_01925   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J4G78_01925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF5783 DUF1493 Motif Other DBs NCBI-ProteinID:  QTD56385 UniProt:  A0ABX7T843 LinkDB All DBs Position complement(387281..387517) Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVEADKVTEEAAFIDDLGADSLDIVELVMAFEEEFSVEIPDDAA EKIATVKDAIDFIDKNKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgagactgcagaccgcgtaaaaaagattgttgttgaacatcttggtgtagaagct gacaaagtgaccgaagaagcggcattcatcgatgatcttggcgctgacagcctcgacatt gttgagcttgtgatggctttcgaagaagaattcagcgtcgaaattcctgacgatgcggct gaaaaaatcgctactgtcaaagatgcaattgatttcatcgacaaaaacaagggttaa

DBGET integrated database retrieval system