Parasphingorhabdus cellanae: J4G78_02320 Help Entry J4G78_02320       CDS       T07111                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism parj  Parasphingorhabdus cellanae Pathway parj01100   Metabolic pathways parj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:parj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J4G78_02320    00074 Mycolic acid biosynthesis     J4G78_02320   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J4G78_02320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QTD56457 LinkDB All DBs Position 471007..471279 Genome browser AA seq 90 aa AA seqDB search MSENMELTPEAAVRAVMQDILGLDAAQVATFTADTELFGALPELDSMAVAGLLTELEDRL DIMIEDDEVDGELFETFGNLVAFAEMKAAE NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtcggaaaatatggaattaacgccggaagctgctgtccgcgccgttatgcaggacatt ttgggactggatgctgctcaagtggccacgtttaccgcagataccgagcttttcggcgct ctacccgaattggacagcatggctgttgcaggccttttgaccgagttggaagaccgtctc gacatcatgatcgaggatgacgaggttgatggcgagctatttgagacatttgggaacctc gtcgcttttgccgagatgaaagccgccgagtga

DBGET integrated database retrieval system