Parasphingorhabdus cellanae: J4G78_02570 Help Entry J4G78_02570       CDS       T07111                                  Name (GenBank) rod-binding protein   KO K02395   peptidoglycan hydrolase FlgJ Organism parj  Parasphingorhabdus cellanae Pathway parj02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:parj00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     J4G78_02570  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:parj02035]     J4G78_02570 Bacterial motility proteins [BR:parj02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     J4G78_02570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding DUF287 Motif Other DBs NCBI-ProteinID:  QTD56499 LinkDB All DBs Position 510342..510620 Genome browser AA seq 92 aa AA seqDB search MTQITSSNRINSRPDIAMDQQKLKQAAQAFEAIFVRNMIGAMRSANLGEDLMGNNGSDQF RTMMDDRIADQMAEHDGLGIADILIAQWKDKI NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgacacagataacatcctctaaccgaattaactctcgtcccgatatcgcgatggatcag caaaagttgaaacaggctgctcaagcgttcgaagccatttttgtccgcaacatgatcggg gccatgcgctcggccaaccttggcgaggatctgatgggtaataatggttctgatcaattt cgcacgatgatggacgatcggattgccgaccagatggcagagcatgatggtctcgggata gcagatattctgatcgcacaatggaaggataagatatga

DBGET integrated database retrieval system