KEGG   Pectobacterium araliae: PEC302110_06490
Entry
PEC302110_06490   CDS       T10257                                 
Symbol
alsS
Name
(GenBank) acetolactate synthase AlsS
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
parl  Pectobacterium araliae
Pathway
parl00290  Valine, leucine and isoleucine biosynthesis
parl00650  Butanoate metabolism
parl00660  C5-Branched dibasic acid metabolism
parl00770  Pantothenate and CoA biosynthesis
parl01100  Metabolic pathways
parl01110  Biosynthesis of secondary metabolites
parl01210  2-Oxocarboxylic acid metabolism
parl01230  Biosynthesis of amino acids
Module
parl_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
parl_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:parl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PEC302110_06490 (alsS)
   00660 C5-Branched dibasic acid metabolism
    PEC302110_06490 (alsS)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    PEC302110_06490 (alsS)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PEC302110_06490 (alsS)
Enzymes [BR:parl01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     PEC302110_06490 (alsS)
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_N TPP_enzyme_M CO_dh
Other DBs
NCBI-ProteinID: BES83552
UniProt: A0AAN0MJC0
LinkDB
Position
734209..735888
AA seq 559 aa
MEKSTEQQSWSCGAALIVKHLEAQGVKHIFGIPGAKIDRVFDELEDSTIQTIPVRHEANG
AFMAAAIGRLTGKAGVTLVTSGPGCSNLVTGLATATAEGDAVVALGGAVKRADKLKLTHQ
SLDTVSLFQPVSKFSAEITAPSAISEVLANAFRSAESGRPGAAFVSLPQDIVNEPVISPV
LACPILPLLNGAPHRDITEAAKRLRQAKNPVLLLGLMASQQENAQALRRFLRHSQLPVTS
TYQAAGVIDQQQFNHFAGRIGLFNNQAGDKLLQQADVIVTVGYSPIEYDPSLWNSGKATL
IHIDVLQAEIDSAYRPDIELIGNIAMTVDALNACISESFILSADTQSVLQDRQRQRHDLS
TRAINMAGFAIHPLRLVRAMQDIVNEDVTLCVDMGSFHIWLARYLYSFRARQILMTNGQQ
TMGVALPWAIAASLVQPGKKVVSVSGDGGFMQSSMELETAVRLKSNLLHIIWVDNGYNMV
EIQQLHKYHRPAGVAFGPIDFKAYAEAFGAKGFAVESADELVSKLRQAMDVDGPAVIAIP
VDYSDNHWLMENLNISVLI
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggaaaagtccaccgaacagcaaagctggagttgcggagccgcgctgattgtaaaacac
ctggaagcgcagggcgtgaagcatatttttggtattcccggcgcaaaaatcgatcgtgtg
tttgatgagctggaagactcgacgatccaaacgatcccagttcggcatgaggcgaacggc
gcgtttatggcggcagcgataggacgtctcacggggaaagcgggggtgacgctggtgaca
tccggccccggctgttcaaatttagtcactgggctggcaacggcgaccgcagagggggac
gcggttgtggcgctgggtggggcggtgaaacgggcggataagcttaagttgacgcaccag
agtctggataccgtcagtctgtttcagcccgtcagtaaattcagtgcggaaatcaccgca
ccttccgctatatcggaagtgttggcgaatgctttcaggtctgcggaaagtggtcgtccg
ggggcggcgtttgtcagcctgccgcaggatatcgttaatgaaccggttattagcccggtg
ctggcctgtccgattttgccgctgttaaacggcgcgccgcatcgcgacatcactgaagcg
gctaaacggctgcggcaggctaaaaatccggtgttgctgctcggattaatggccagccag
caggaaaatgcgcaggcactacgccgttttctgcgccacagccagttgccggtgaccagt
acgtatcaggctgcgggagtcatcgatcagcaacaattcaatcattttgccgggcgtatt
gggttatttaacaatcaggcaggtgacaagctgctacagcaggcggatgtaatcgtcact
gtaggttacagcccgattgagtatgatccatcgttgtggaatagcggcaaagcgacgctg
atccacatcgatgtgctacaagcggagatcgacagtgcttaccggcctgatatcgagctg
atcgggaatatcgcgatgacggtggacgcgctgaatgcgtgtatcagtgaatcgtttatc
ttgtctgctgatacacagtccgtattgcaggatcggcagcgtcagcggcacgatctcagc
actcgcgccatcaacatggcggggtttgcgattcaccctctgcggttggtgcgcgcgatg
caggatatcgtgaatgaggatgtcacgttgtgtgtcgatatggggagtttccatatctgg
ctggcgcgttacctgtatagcttccgggcacgacagattctgatgactaacggtcagcag
accatgggcgtagcgttgccgtgggcaatcgccgcatcgctggtacaacccggcaaaaaa
gtggtgtctgtttctggcgacggcgggtttatgcaatccagcatggagctggaaacggcg
gtgcgtctgaaaagcaatctcctgcatatcatctgggtggataacggctacaacatggtg
gaaatccaacagttgcataaataccatcgtccggcgggcgtagcgtttgggccgattgat
ttcaaagcctatgcggaagcctttggcgcaaaagggtttgcggtggaatcggctgatgaa
ctggtcagcaaactccgtcaggcaatggacgttgacggcccagcggtgattgccatcccg
gttgattattccgataaccattggctgatggagaacctgaatatcagtgtgctgatttag

DBGET integrated database retrieval system