Paraconexibacter antarcticus: NBH00_06325 Help Entry NBH00_06325       CDS       T08278                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism parn  Paraconexibacter antarcticus Pathway parn00030   Pentose phosphate pathway parn00051   Fructose and mannose metabolism parn00710   Carbon fixation by Calvin cycle parn01100   Metabolic pathways parn01110   Biosynthesis of secondary metabolites parn01120   Microbial metabolism in diverse environments parn01200   Carbon metabolism parn01230   Biosynthesis of amino acids Module parn_M00004   Pentose phosphate pathway (Pentose phosphate cycle) parn_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:parn00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     NBH00_06325 (rpiB)    00051 Fructose and mannose metabolism     NBH00_06325 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     NBH00_06325 (rpiB) Enzymes [BR:parn01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      NBH00_06325 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB PTS_IIB Motif Other DBs NCBI-ProteinID:  UTI65829 LinkDB All DBs Position 1255412..1255846 Genome browser AA seq 144 aa AA seqDB search MRIAVGSDHAGFHLKEHVKATLVEAGHEVLDVGTATADSVDYPSYAREAAELVASGGAEV GVIACGSGVGVSIVANKVGGVRAVNAHDPAEAEMSRRHNDANVVTLSGARLKPEQADAIV ATFLATDFEGGRHARRVGQIDTPA NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgcgcatcgccgtcggctccgaccacgccgggttccacctcaaggagcacgtgaaggcg accctcgtcgaggccggtcacgaggtcctcgacgtcggcaccgccaccgccgactccgtc gactacccgtcgtacgcccgcgaggcggccgagctcgtcgcgtccggcggcgccgaggtc ggcgtcatcgcctgcggctcgggcgtcggcgtctcgatcgtcgcgaacaaggtcggcggt gtgcgggcggtcaacgcccacgacccggccgaggccgagatgtcccgccggcacaacgac gcgaacgtcgtgacgctctccggcgcccggctgaagcccgagcaggcggacgcgatcgtc gcgaccttcctcgccaccgacttcgagggtggacgccacgcccgccgcgtcggccagatc gacaccccggcttga

DBGET integrated database retrieval system