Paracoccus tegillarcae: CUV01_11820
Help
Entry
CUV01_11820 CDS
T05237
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
paro
Paracoccus tegillarcae
Pathway
paro00770
Pantothenate and CoA biosynthesis
paro01100
Metabolic pathways
paro01240
Biosynthesis of cofactors
Module
paro_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
paro00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
CUV01_11820
Enzymes [BR:
paro01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
CUV01_11820
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID:
AUH33989
UniProt:
A0A2K9EI09
LinkDB
All DBs
Position
2416919..2417410
Genome browser
AA seq
163 aa
AA seq
DB search
MRIGLYPGTFDPITLGHVDIIERAMALVDRLVIGVAVNKDKRPLFDLDERVAMVTRECAS
IAEKTGGEILVHPFDNLLIHCARDVGAGVIIRGLRAVADFEYEFQMVGMNRAMDASIETV
FMMADAQRQAIASRLVKEIARLGGDVSRFVTDDVRTELLERLR
NT seq
492 nt
NT seq
+upstream
nt +downstream
nt
atgcgcatcgggctttaccctggcacattcgaccccatcacattgggccatgtcgatatc
atcgagcgtgcgatggcgctggtggatcggttggtcatcggcgtcgcggtgaacaaggac
aagcggcccttgtttgatctggacgagcgggtggcgatggtcacgcgggaatgcgccagt
atcgctgaaaagaccggcggcgagattctggttcacccctttgacaacctgctgatccac
tgtgcccgcgatgtcggcgccggtgtgatcattcgcggcctgcgggcggtggcggatttc
gaatacgaattccagatggtcggcatgaaccgcgccatggatgccagcatcgagaccgtg
ttcatgatggcggatgcgcaacggcaggccattgcctcgcggttggtgaaagagatcgcc
cggcttggtggcgatgtgtccagattcgtgaccgatgacgttcggaccgaattgctggaa
cggctcaggtaa
DBGET
integrated database retrieval system