Parasphingopyxis sp. CP4: HFP51_02735 Help Entry HFP51_02735       CDS       T09836                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism parp  Parasphingopyxis sp. CP4 Pathway parp01100   Metabolic pathways parp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:parp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HFP51_02735    00074 Mycolic acid biosynthesis     HFP51_02735   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HFP51_02735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  QLC21195 LinkDB All DBs Position 549986..550222 Genome browser AA seq 78 aa AA seqDB search MSDTADRVKKIVTEHLGVEADKVTEDAAFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EDIATVKDAIAYIDKQNA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgccgatcgggtgaaaaagatcgtcaccgagcatcttggggtcgaagcc gacaaggtcaccgaagatgcagcctttatcgatgatctgggcgctgacagcctcgatatc gtcgagctggtaatggcattcgaagaagagtttggcgtcgaaattcccgacgatgctgcc gaagacattgcgaccgttaaggacgcaattgcatatatcgacaagcagaacgcctga

DBGET integrated database retrieval system